PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G275400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 464aa    MW: 49542.4 Da    PI: 8.5793
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G275400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-1659103147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++E++++++a +++G   W++I +++g ++t+ q++s+ qk+
  Seita.1G275400.1.p  59 REKWTEDEHKRFLEALQLHGRA-WRRIQEHIG-TKTAVQIRSHAQKF 103
                         789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.36E-1553107IPR009057Homeodomain-like
PROSITE profilePS5129419.19154108IPR017930Myb domain
TIGRFAMsTIGR015577.3E-1657106IPR006447Myb domain, plants
SMARTSM007172.0E-1258106IPR001005SANT/Myb domain
PfamPF002492.4E-1459102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-95999IPR009057Homeodomain-like
CDDcd001679.31E-1061104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAYLEENQLA TDEVAVAVGA GGEAAVDHRK DPLDPSDMDL SGEEHVPKAR KPYTITKQRE  60
KWTEDEHKRF LEALQLHGRA WRRIQEHIGT KTAVQIRSHA QKFFTKVVRE SSGSNTAGGA  120
APAIQIPPPR PKRKPAHPYP RKVDGAAKKH VPALKQLEKP PLRTQSLRDQ DDGSPTSVLT  180
TARTVLRAEA LGSVFANSSS GSRSPAPSAT GSDEPSSVDR EDGCVSPSVA TAELVARTAN  240
TKVFGDGKVS CIGTEASVFK LFGKKVVVKD PLEHLKTDAS ATSVAQATRN AIPFGAAEGS  300
SWNPWPTGVQ MQQLMYFVPQ PDGFAAQSAV PWLAYNGALP CALFYPQAAA PSAQHHHHNQ  360
PSEPLNHKRV QREESLTGSN TASSAVPAAS AAQNSDAAES HGPRQENTSE SAIAVPRLTK  420
CPSSASFSRR GFVPYKRCAA ESEAPRPVAA GEEADGELTR LCL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9651821e-132EU965182.1 Zea mays clone 284337 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953478.10.0PREDICTED: protein REVEILLE 2-like isoform X2
TrEMBLK3YSP40.0K3YSP4_SETIT; Uncharacterized protein
STRINGSi017289m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27223686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.18e-35MYB_related family protein